General Information

  • ID:  hor002832
  • Uniprot ID:  Q8T0Y7
  • Protein name:  CP2-derived peptide 9
  • Gene name:  CP2PP
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  Animal
  • Expression:  Neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SSERWAPKS
  • Length:  9(89-97)
  • Propeptide:  MDSRICTSFARLMASALCVSTLLVTAMPFDLRRGSSDTDLDLQGHVDLGLDDLDKLRLIFPPGLIEEAFSQAQGKVDMPLPRQRTSSRSSERWAPKSKRFDFGFAGLDTYDAIHRALEQPARGTSNSGSGYNMLMKMQRHG
  • Signal peptide:  MDSRICTSFARLMASALCVSTLLVTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Mediates intrinsic neuromodulation
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8T0Y7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002832_AF2.pdbhor002832_ESM.pdb

Physical Information

Mass: 118999 Formula: C45H70N14O15
Absent amino acids: CDFGHILMNQTVY Common amino acids: S
pI: 9.69 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: -166.67 Boman Index: -3334
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 11.11
Instability Index: 12003.33 Extinction Coefficient cystines: 5500
Absorbance 280nm: 687.5

Literature

  • PubMed ID:  11786187
  • Title:  Cloning, Expression and Processing of the CP2 Neuropeptide Precursor of Aplysia